PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_10556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 981aa    MW: 107708 Da    PI: 5.1603
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_10556.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-185096148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
     MLOC_10556.1 50 KGNWTREEDDILSRAVQTYNGKHWKKIAECFP-GRTDVQCLHRWQKVL 96
                     79******************************.************986 PP

2Myb_DNA-binding61.22.2e-19102148148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ vk++G++ W+tIa+ ++ gR +kqc++rw+++l
     MLOC_10556.1 102 KGPWSKEEDDIIVEMVKKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                      79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15154196145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
     MLOC_10556.1 154 KDAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 196
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.764596IPR017930Myb domain
SuperFamilySSF466899.33E-1948110IPR009057Homeodomain-like
SMARTSM007171.1E-164998IPR001005SANT/Myb domain
PfamPF002491.4E-155096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2452113IPR009057Homeodomain-like
CDDcd001673.94E-145296No hitNo description
PROSITE profilePS5129432.21597152IPR017930Myb domain
SuperFamilySSF466892.66E-3199195IPR009057Homeodomain-like
SMARTSM007171.2E-18101150IPR001005SANT/Myb domain
CDDcd001674.65E-16104148No hitNo description
PfamPF139213.8E-18105165No hitNo description
Gene3DG3DSA:1.10.10.601.5E-26114155IPR009057Homeodomain-like
SMARTSM007171.9E-14153201IPR001005SANT/Myb domain
PROSITE profilePS5129419.934153203IPR017930Myb domain
CDDcd001674.08E-11156196No hitNo description
Gene3DG3DSA:1.10.10.601.6E-21156203IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
MTSDKGKASK KAGEASGQPS TTHEGKVNNE PQRQRSINGR TTGPTRRSTK GNWTREEDDI  60
LSRAVQTYNG KHWKKIAECF PGRTDVQCLH RWQKVLNPEL IKGPWSKEED DIIVEMVKKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKDAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNS IKNHWNSSVK KKIDSYMSSG LLAQVSRLPL VEHHAHFSSS PAITQQNSED  240
SESNAVREVE DSSGCSQSSL GIVSCSQVQD TNLTLSCDLH VNADPSKTEA HDSQSSMCQE  300
GYTSTEGVAS VMSEVHCHVP SSRFDPDTLL QQEISQRMNS QMDVDEIPGN SMFENNQTIC  360
STSNNERPML QYEIASDMPI SVLTNVSGAE QKLHFMSEAD FSSPNCLKSE LWQDISFQSL  420
LSGPDVVDAD SLSRPNHQSE THSSEANINF LAAPNPSHTS DPSSMMVVAY GQDPSMSVPQ  480
SLISNGLSDA ADEESREMQA SGSEMITCIH DSFGDSEQFA TPGSTDGRHG SSATIERIPE  540
YGDKQLTDAE EPAACMAKEP SMAQGEAVPD EKQDKGALFY EPPRFPSMDV PFVSCDLVTS  600
GDLQEYSPLG IRQLMRSTMS VTTPLRLWGS PTHDESPDVV LKSAAKSFIS TPSILKKRPR  660
DLLSPTSEKG IEKKSRTEQD SSVLGTSSVS AQTSCMHAIK DKAIVTESVF CTNRSSSFKP  720
LEKKLEFCDE NKDNLGESEQ AKDGRNAQNN YSVDEHARGE QCSTANMVNI NDEPPATVLV  780
EHKGNDISDH GANAMYQKMN TSLEALSACK ETFAKSKSGE LIAEKSSPCI HMDYEYVNIL  840
ADTPGAKRGL ESPSAWKSPW FIDMQYKGSY FISPADATYD ALGLMKRINV QSASALADAR  900
EVLASGSQCG NRNFDEENKE NIDAENETGT GKPQTKIMTE ARVLDFNECA TPVRTAGSSV  960
GGSLAKSVSS PIPSSHLKNF R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9968270.0HE996827.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_69800.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLM0UFS20.0M0UFS2_HORVD; Uncharacterized protein
STRINGMLOC_10556.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.21e-161Homeodomain-like protein